Recombinant Human ARMCX3 protein, GST-tagged
| Cat.No. : | ARMCX3-835H |
| Product Overview : | Human ARMCX3 full-length ORF ( NP_057691.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 68.9 kDa |
| AA Sequence : | MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARMCX3 armadillo repeat containing, X-linked 3 [ Homo sapiens ] |
| Official Symbol | ARMCX3 |
| Synonyms | ARMCX3; armadillo repeat containing, X-linked 3; armadillo repeat-containing X-linked protein 3; ALEX3; 1200004E24Rik; arm protein lost in epithelial cancers, X chromosome, 3; ARM protein lost in epithelial cancers on chromosome X 3; dJ545K15.2; KIAA0443; MGC12199; DKFZp781N1954; |
| Gene ID | 51566 |
| mRNA Refseq | NM_016607 |
| Protein Refseq | NP_057691 |
| MIM | 300364 |
| UniProt ID | Q9UH62 |
| ◆ Recombinant Proteins | ||
| ARMCX3-412R | Recombinant Rhesus monkey ARMCX3 Protein, His-tagged | +Inquiry |
| ARMCX3-792R | Recombinant Rat ARMCX3 Protein | +Inquiry |
| ARMCX3-1289HF | Recombinant Full Length Human ARMCX3 Protein, GST-tagged | +Inquiry |
| ARMCX3-741M | Recombinant Mouse ARMCX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARMCX3-448R | Recombinant Rat ARMCX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARMCX3-8694HCL | Recombinant Human ARMCX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMCX3 Products
Required fields are marked with *
My Review for All ARMCX3 Products
Required fields are marked with *
