Recombinant Human ARMCX3 protein, GST-tagged

Cat.No. : ARMCX3-835H
Product Overview : Human ARMCX3 full-length ORF ( NP_057691.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 68.9 kDa
AA Sequence : MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMCX3 armadillo repeat containing, X-linked 3 [ Homo sapiens ]
Official Symbol ARMCX3
Synonyms ARMCX3; armadillo repeat containing, X-linked 3; armadillo repeat-containing X-linked protein 3; ALEX3; 1200004E24Rik; arm protein lost in epithelial cancers, X chromosome, 3; ARM protein lost in epithelial cancers on chromosome X 3; dJ545K15.2; KIAA0443; MGC12199; DKFZp781N1954;
Gene ID 51566
mRNA Refseq NM_016607
Protein Refseq NP_057691
MIM 300364
UniProt ID Q9UH62

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMCX3 Products

Required fields are marked with *

My Review for All ARMCX3 Products

Required fields are marked with *

0
cart-icon