Active Recombinant Human ARMETL1 protein

• Cat.No.: ARMETL1-839H
• Product Overview: Human ARMETL1 (Q49AH0) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: CDNF (Cerebral Dopamine Neurotrophic Factor) is a Protein Coding gene. GO annotations related to this gene include growth factor activity. An important paralog of this gene is MANF.
• Form: Lyophilized
• Bio-activity: Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 for this effect is 15-25 ug/mL.
• Molecular Mass: 18.5 kDa
• AA Sequence: MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 98%
• Applications: Functional Study; SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ]
• Official Symbol: CDNF
• Synonyms: CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1
• Gene ID: 441549
• mRNA Refseq: NM_001029954
• Protein Refseq: NP_001025125
• MIM: 611233
• UniProt ID: Q49AH0