Recombinant Human ARMS2 protein, GST-tagged
Cat.No. : | ARMS2-840H |
Product Overview : | Human ARMS2 full-length ORF ( AAI60152.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens ] |
Official Symbol | ARMS2 |
Synonyms | ARMS2; age-related maculopathy susceptibility 2; age-related maculopathy susceptibility protein 2; LOC387715; ARMD8; |
Gene ID | 387715 |
mRNA Refseq | NM_001099667 |
Protein Refseq | NP_001093137 |
MIM | 611313 |
UniProt ID | P0C7Q2 |
◆ Recombinant Proteins | ||
ARMS2-1314HF | Recombinant Full Length Human ARMS2 Protein, GST-tagged | +Inquiry |
ARMS2-379H | Recombinant Human ARMS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARMS2-3794H | Recombinant Human ARMS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARMS2-1932HFL | Recombinant Full Length Human ARMS2 Protein, C-Flag-tagged | +Inquiry |
ARMS2-840H | Recombinant Human ARMS2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMS2-8693HCL | Recombinant Human ARMS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMS2 Products
Required fields are marked with *
My Review for All ARMS2 Products
Required fields are marked with *