Recombinant Human ARMS2 protein, GST-tagged

Cat.No. : ARMS2-840H
Product Overview : Human ARMS2 full-length ORF ( AAI60152.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration. [provided by RefSeq, Oct 2008]
Molecular Mass : 11.8 kDa
AA Sequence : MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens ]
Official Symbol ARMS2
Synonyms ARMS2; age-related maculopathy susceptibility 2; age-related maculopathy susceptibility protein 2; LOC387715; ARMD8;
Gene ID 387715
mRNA Refseq NM_001099667
Protein Refseq NP_001093137
MIM 611313
UniProt ID P0C7Q2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMS2 Products

Required fields are marked with *

My Review for All ARMS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon