Recombinant Human ARMS2 protein, GST-tagged

• Cat.No.: ARMS2-840H
• Product Overview: Human ARMS2 full-length ORF ( AAI60152.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration. [provided by RefSeq, Oct 2008]
• Molecular Mass: 11.8 kDa
• AA Sequence: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens ]
• Official Symbol: ARMS2
• Synonyms: ARMS2; age-related maculopathy susceptibility 2; age-related maculopathy susceptibility protein 2; LOC387715; ARMD8
• Gene ID: 387715
• mRNA Refseq: NM_001099667
• Protein Refseq: NP_001093137
• MIM: 611313
• UniProt ID: P0C7Q2