Recombinant Human ARMS2 protein, GST-tagged
| Cat.No. : | ARMS2-840H |
| Product Overview : | Human ARMS2 full-length ORF ( AAI60152.1, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that is thought to play a role in diseases in the elderly. Mutations in this gene have been associated with age-related macular degeneration. [provided by RefSeq, Oct 2008] |
| Molecular Mass : | 11.8 kDa |
| AA Sequence : | MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens ] |
| Official Symbol | ARMS2 |
| Synonyms | ARMS2; age-related maculopathy susceptibility 2; age-related maculopathy susceptibility protein 2; LOC387715; ARMD8; |
| Gene ID | 387715 |
| mRNA Refseq | NM_001099667 |
| Protein Refseq | NP_001093137 |
| MIM | 611313 |
| UniProt ID | P0C7Q2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMS2 Products
Required fields are marked with *
My Review for All ARMS2 Products
Required fields are marked with *



