Recombinant Human ARNT2 protein, GST-tagged
Cat.No. : | ARNT2-841H |
Product Overview : | Human ARNT2 partial ORF ( NP_055677.3, 464 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq, Dec 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARNT2 aryl-hydrocarbon receptor nuclear translocator 2 [ Homo sapiens ] |
Official Symbol | ARNT2 |
Synonyms | ARNT2; aryl-hydrocarbon receptor nuclear translocator 2; aryl hydrocarbon receptor nuclear translocator 2; bHLHe1; KIAA0307; ARNT protein 2; class E basic helix-loop-helix protein 1; |
Gene ID | 9915 |
mRNA Refseq | NM_014862 |
Protein Refseq | NP_055677 |
MIM | 606036 |
UniProt ID | Q9HBZ2 |
◆ Recombinant Proteins | ||
ARNT2-451R | Recombinant Rat ARNT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARNT2-9202Z | Recombinant Zebrafish ARNT2 | +Inquiry |
ARNT2-841H | Recombinant Human ARNT2 protein, GST-tagged | +Inquiry |
ARNT2-795R | Recombinant Rat ARNT2 Protein | +Inquiry |
ARNT2-523H | Recombinant Human ARNT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARNT2-8691HCL | Recombinant Human ARNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARNT2 Products
Required fields are marked with *
My Review for All ARNT2 Products
Required fields are marked with *
0
Inquiry Basket