Recombinant Human ARNT2 protein, GST-tagged

• Cat.No.: ARNT2-841H
• Product Overview: Human ARNT2 partial ORF ( NP_055677.3, 464 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq, Dec 2013]
• Molecular Mass: 36.74 kDa
• AA Sequence: VPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARNT2 aryl-hydrocarbon receptor nuclear translocator 2 [ Homo sapiens ]
• Official Symbol: ARNT2
• Synonyms: ARNT2; aryl-hydrocarbon receptor nuclear translocator 2; aryl hydrocarbon receptor nuclear translocator 2; bHLHe1; KIAA0307; ARNT protein 2; class E basic helix-loop-helix protein 1
• Gene ID: 9915
• mRNA Refseq: NM_014862
• Protein Refseq: NP_055677
• MIM: 606036
• UniProt ID: Q9HBZ2