Recombinant Human ARNT2 protein, GST-tagged

Cat.No. : ARNT2-841H
Product Overview : Human ARNT2 partial ORF ( NP_055677.3, 464 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq, Dec 2013]
Molecular Mass : 36.74 kDa
AA Sequence : VPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARNT2 aryl-hydrocarbon receptor nuclear translocator 2 [ Homo sapiens ]
Official Symbol ARNT2
Synonyms ARNT2; aryl-hydrocarbon receptor nuclear translocator 2; aryl hydrocarbon receptor nuclear translocator 2; bHLHe1; KIAA0307; ARNT protein 2; class E basic helix-loop-helix protein 1;
Gene ID 9915
mRNA Refseq NM_014862
Protein Refseq NP_055677
MIM 606036
UniProt ID Q9HBZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARNT2 Products

Required fields are marked with *

My Review for All ARNT2 Products

Required fields are marked with *

0
cart-icon