Recombinant Human ARPC1B protein, His-tagged
Cat.No. : | ARPC1B-3841H |
Product Overview : | Recombinant Human ARPC1B protein(265-372 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 265-372 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARPC1B actin related protein 2/3 complex, subunit 1B, 41kDa [ Homo sapiens ] |
Official Symbol | ARPC1B |
Synonyms | ARPC1B; actin related protein 2/3 complex, subunit 1B, 41kDa; actin related protein 2/3 complex, subunit 1B (41 kD); actin-related protein 2/3 complex subunit 1B; actin related protein 2/3 complex; subunit 1A (41 kD); ARC41; ARP2/3 protein complex subunit p41; p40 ARC; p41 ARC; arp2/3 complex 41 kDa subunit; p40-ARC; p41-ARC; |
Gene ID | 10095 |
mRNA Refseq | NM_005720 |
Protein Refseq | NP_005711 |
MIM | 604223 |
UniProt ID | O15143 |
◆ Recombinant Proteins | ||
ARPC1B-845H | Recombinant Human ARPC1B protein, GST-tagged | +Inquiry |
ARPC1B-798R | Recombinant Rat ARPC1B Protein | +Inquiry |
ARPC1B-1258H | Recombinant Human ARPC1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARPC1B-2019HFL | Recombinant Full Length Human ARPC1B Protein, C-Flag-tagged | +Inquiry |
ARPC1B-1102HF | Recombinant Full Length Human ARPC1B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC1B-8686HCL | Recombinant Human ARPC1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARPC1B Products
Required fields are marked with *
My Review for All ARPC1B Products
Required fields are marked with *