Recombinant Human ARPC1B protein, His-tagged

Cat.No. : ARPC1B-3841H
Product Overview : Recombinant Human ARPC1B protein(265-372 aa), fused to His tag, was expressed in E. coli.
Availability August 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 265-372 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ARPC1B actin related protein 2/3 complex, subunit 1B, 41kDa [ Homo sapiens ]
Official Symbol ARPC1B
Synonyms ARPC1B; actin related protein 2/3 complex, subunit 1B, 41kDa; actin related protein 2/3 complex, subunit 1B (41 kD); actin-related protein 2/3 complex subunit 1B; actin related protein 2/3 complex; subunit 1A (41 kD); ARC41; ARP2/3 protein complex subunit p41; p40 ARC; p41 ARC; arp2/3 complex 41 kDa subunit; p40-ARC; p41-ARC;
Gene ID 10095
mRNA Refseq NM_005720
Protein Refseq NP_005711
MIM 604223
UniProt ID O15143

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPC1B Products

Required fields are marked with *

My Review for All ARPC1B Products

Required fields are marked with *

0
cart-icon