Recombinant Human ARPC5 protein, GST-tagged

Cat.No. : ARPC5-849H
Product Overview : Human ARPC5 full-length ORF ( AAH57237, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Molecular Mass : 42.68 kDa
AA Sequence : MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPC5 actin related protein 2/3 complex, subunit 5, 16kDa [ Homo sapiens ]
Official Symbol ARPC5
Synonyms ARPC5; actin related protein 2/3 complex, subunit 5, 16kDa; actin related protein 2/3 complex, subunit 5 (16 kD); actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 protein complex subunit p16; dJ127C7.3; p16 Arc; arp2/3 complex 16 kDa subunit; p16-Arc; MGC88523;
Gene ID 10092
mRNA Refseq NM_005717
Protein Refseq NP_005708
MIM 604227
UniProt ID O15511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPC5 Products

Required fields are marked with *

My Review for All ARPC5 Products

Required fields are marked with *

0
cart-icon