Recombinant Human ARPC5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARPC5-2106H |
Product Overview : | ARPC5 MS Standard C13 and N15-labeled recombinant protein (NP_005708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARPC5 actin related protein 2/3 complex subunit 5 [ Homo sapiens (human) ] |
Official Symbol | ARPC5 |
Synonyms | ARPC5; actin related protein 2/3 complex, subunit 5, 16kDa; actin related protein 2/3 complex, subunit 5 (16 kD); actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 protein complex subunit p16; dJ127C7.3; p16 Arc; arp2/3 complex 16 kDa subunit; p16-Arc; MGC88523; |
Gene ID | 10092 |
mRNA Refseq | NM_005717 |
Protein Refseq | NP_005708 |
MIM | 604227 |
UniProt ID | O15511 |
◆ Recombinant Proteins | ||
ARPC5-151H | Recombinant Human ARPC5 Protein, His-tagged | +Inquiry |
Arpc5-1727M | Recombinant Mouse Arpc5 Protein, Myc/DDK-tagged | +Inquiry |
ARPC5-799R | Recombinant Rat ARPC5 Protein | +Inquiry |
ARPC5-849H | Recombinant Human ARPC5 protein, GST-tagged | +Inquiry |
ARPC5-3539H | Recombinant Human ARPC5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC5-8683HCL | Recombinant Human ARPC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPC5 Products
Required fields are marked with *
My Review for All ARPC5 Products
Required fields are marked with *
0
Inquiry Basket