Recombinant Human ARPC5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARPC5-2106H
Product Overview : ARPC5 MS Standard C13 and N15-labeled recombinant protein (NP_005708) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
Molecular Mass : 16.1 kDa
AA Sequence : MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARPC5 actin related protein 2/3 complex subunit 5 [ Homo sapiens (human) ]
Official Symbol ARPC5
Synonyms ARPC5; actin related protein 2/3 complex, subunit 5, 16kDa; actin related protein 2/3 complex, subunit 5 (16 kD); actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 protein complex subunit p16; dJ127C7.3; p16 Arc; arp2/3 complex 16 kDa subunit; p16-Arc; MGC88523;
Gene ID 10092
mRNA Refseq NM_005717
Protein Refseq NP_005708
MIM 604227
UniProt ID O15511

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPC5 Products

Required fields are marked with *

My Review for All ARPC5 Products

Required fields are marked with *

0
cart-icon