Recombinant Human ARPIN Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARPIN-121H |
Product Overview : | C15orf38 MS Standard C13 and N15-labeled recombinant protein (NP_872422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARPIN actin related protein 2/3 complex inhibitor [ Homo sapiens (human) ] |
Official Symbol | ARPIN |
Synonyms | ARPIN; actin related protein 2/3 complex inhibitor; C15orf38; arpin; UPF0552 protein C15orf38; arp2/3 inhibition protein |
Gene ID | 348110 |
mRNA Refseq | NM_182616 |
Protein Refseq | NP_872422 |
MIM | 615543 |
UniProt ID | Q7Z6K5 |
◆ Recombinant Proteins | ||
Arpin-1728M | Recombinant Mouse Arpin Protein, Myc/DDK-tagged | +Inquiry |
ARPIN-151H | Recombinant Human ARPIN Protein, His-tagged | +Inquiry |
ARPIN-606H | Recombinant Human ARPIN Protein, MYC/DDK-tagged | +Inquiry |
ARPIN-121H | Recombinant Human ARPIN Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARPIN-2522Z | Recombinant Zebrafish ARPIN | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPIN-82HCL | Recombinant Human ARPIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARPIN Products
Required fields are marked with *
My Review for All ARPIN Products
Required fields are marked with *