Recombinant Human ARPIN Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARPIN-121H
• Product Overview: C15orf38 MS Standard C13 and N15-labeled recombinant protein (NP_872422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.
• Molecular Mass: 24.9 kDa
• AA Sequence: MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARPIN actin related protein 2/3 complex inhibitor [ Homo sapiens (human) ]
• Official Symbol: ARPIN
• Synonyms: ARPIN; actin related protein 2/3 complex inhibitor; C15orf38; arpin; UPF0552 protein C15orf38; arp2/3 inhibition protein
• Gene ID: 348110
• mRNA Refseq: NM_182616
• Protein Refseq: NP_872422
• MIM: 615543
• UniProt ID: Q7Z6K5