Recombinant Human ARPIN Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : ARPIN-121H
Product Overview : C15orf38 MS Standard C13 and N15-labeled recombinant protein (NP_872422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.
Molecular Mass : 24.9 kDa
AA Sequence : MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARPIN actin related protein 2/3 complex inhibitor [ Homo sapiens (human) ]
Official Symbol ARPIN
Synonyms ARPIN; actin related protein 2/3 complex inhibitor; C15orf38; arpin; UPF0552 protein C15orf38; arp2/3 inhibition protein
Gene ID 348110
mRNA Refseq NM_182616
Protein Refseq NP_872422
MIM 615543
UniProt ID Q7Z6K5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPIN Products

Required fields are marked with *

My Review for All ARPIN Products

Required fields are marked with *

0
cart-icon