Recombinant Human ARR3 protein, GST-tagged
| Cat.No. : | ARR3-854H |
| Product Overview : | Human ARR3 full-length ORF ( AAH12096, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function. [provided by RefSeq, May 2016] |
| Molecular Mass : | 65.01 kDa |
| AA Sequence : | MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSYEAAR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARR3 arrestin 3, retinal (X-arrestin) [ Homo sapiens ] |
| Official Symbol | ARR3 |
| Synonyms | ARR3; arrestin 3, retinal (X-arrestin); arrestin-C; arrestin 4; ARRX; cArr; C-arrestin; X-arrestin; cone arrestin; retinal cone arrestin-3; |
| Gene ID | 407 |
| mRNA Refseq | NM_004312 |
| Protein Refseq | NP_004303 |
| MIM | 301770 |
| UniProt ID | P36575 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARR3 Products
Required fields are marked with *
My Review for All ARR3 Products
Required fields are marked with *




