Recombinant Human ARR3 protein, GST-tagged
Cat.No. : | ARR3-854H |
Product Overview : | Human ARR3 full-length ORF ( AAH12096, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a non-visual arrestin which binds to agonist-activated, phosphorylated G protein-coupled receptors. This binding uncouples the receptor from the heterotrimeric G protein, resulting in termination of the G protein-coupled receptor signaling. The encoded protein also is a part of the centrosome, interacting with gamma-tubulin to help regulate proper centrosome function. [provided by RefSeq, May 2016] |
Molecular Mass : | 65.01 kDa |
AA Sequence : | MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSYEAAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARR3 arrestin 3, retinal (X-arrestin) [ Homo sapiens ] |
Official Symbol | ARR3 |
Synonyms | ARR3; arrestin 3, retinal (X-arrestin); arrestin-C; arrestin 4; ARRX; cArr; C-arrestin; X-arrestin; cone arrestin; retinal cone arrestin-3; |
Gene ID | 407 |
mRNA Refseq | NM_004312 |
Protein Refseq | NP_004303 |
MIM | 301770 |
UniProt ID | P36575 |
◆ Recombinant Proteins | ||
ARR3-26077TH | Recombinant Human ARR3 | +Inquiry |
ARR3-1243HF | Recombinant Full Length Human ARR3 Protein, GST-tagged | +Inquiry |
Arr3-3641R | Recombinant Rat Arr3, GST-tagged | +Inquiry |
ARR3-3694C | Recombinant Chicken ARR3 | +Inquiry |
ARR3-26078TH | Recombinant Human ARR3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARR3-129HCL | Recombinant Human ARR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARR3 Products
Required fields are marked with *
My Review for All ARR3 Products
Required fields are marked with *
0
Inquiry Basket