Recombinant Human ARRDC1 Protein, His-tagged
| Cat.No. : | ARRDC1-22H |
| Product Overview : | Recombinant Human ARRDC1 Protein(1-98 aa), fused with N-terminal His Tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-98 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAWVVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | ARRDC1 arrestin domain containing 1 [ Homo sapiens ] |
| Official Symbol | ARRDC1 |
| Synonyms | RP11-48C7.5 |
| Gene ID | 92714 |
| mRNA Refseq | NM_152285.2 |
| Protein Refseq | NP_689498.1 |
| UniProt ID | Q8N5I2 |
| ◆ Recombinant Proteins | ||
| Arrdc1-1729M | Recombinant Mouse Arrdc1 Protein, Myc/DDK-tagged | +Inquiry |
| ARRDC1-856H | Recombinant Human ARRDC1 protein, GST-tagged | +Inquiry |
| ARRDC1-1235HFL | Recombinant Full Length Human ARRDC1 Protein, C-Flag-tagged | +Inquiry |
| ARRDC1-3032H | Recombinant Human ARRDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARRDC1-754M | Recombinant Mouse ARRDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARRDC1-8678HCL | Recombinant Human ARRDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRDC1 Products
Required fields are marked with *
My Review for All ARRDC1 Products
Required fields are marked with *




