Recombinant Human ARSB
| Cat.No. : | ARSB-26104TH |
| Product Overview : | Recombinant fragment of Human ARSB with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH |
| Sequence Similarities : | Belongs to the sulfatase family. |
| Gene Name | ARSB arylsulfatase B [ Homo sapiens ] |
| Official Symbol | ARSB |
| Synonyms | ARSB; arylsulfatase B; |
| Gene ID | 411 |
| mRNA Refseq | NM_000046 |
| Protein Refseq | NP_000037 |
| MIM | 611542 |
| Uniprot ID | P15848 |
| Chromosome Location | 5p11-q13 |
| Pathway | Chondroitin sulfate degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; |
| Function | N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity; catalytic activity; hydrolase activity; metal ion binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *




