Recombinant Human ARSB
Cat.No. : | ARSB-26104TH |
Product Overview : | Recombinant fragment of Human ARSB with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targetted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH |
Sequence Similarities : | Belongs to the sulfatase family. |
Gene Name | ARSB arylsulfatase B [ Homo sapiens ] |
Official Symbol | ARSB |
Synonyms | ARSB; arylsulfatase B; |
Gene ID | 411 |
mRNA Refseq | NM_000046 |
Protein Refseq | NP_000037 |
MIM | 611542 |
Uniprot ID | P15848 |
Chromosome Location | 5p11-q13 |
Pathway | Chondroitin sulfate degradation, organism-specific biosystem; Chondroitin sulfate degradation, conserved biosystem; Dermatan sulfate degradation, organism-specific biosystem; Dermatan sulfate degradation, conserved biosystem; Glycosaminoglycan degradation, organism-specific biosystem; |
Function | N-acetylgalactosamine-4-sulfatase activity; arylsulfatase activity; catalytic activity; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
ARSB-1862HFL | Recombinant Full Length Human ARSB Protein, C-Flag-tagged | +Inquiry |
ARSB-1080B | Recombinant Bacillus subtilis ARSB protein, His-tagged | +Inquiry |
ARSB-3370H | Recombinant Human ARSB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARSB-26104TH | Recombinant Human ARSB | +Inquiry |
ARSB-383H | Recombinant Human ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSB-8677HCL | Recombinant Human ARSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSB Products
Required fields are marked with *
My Review for All ARSB Products
Required fields are marked with *