Recombinant Human ARSE protein, GST-tagged
| Cat.No. : | ARSE-7877H |
| Product Overview : | Recombinant Human ARSE protein(524-567 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 524-567 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | HILTPASEPVFYQVMERVQQAVWEHQRTLSPVPLQLDRLGNIWR |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | ARSE arylsulfatase E (chondrodysplasia punctata 1) [ Homo sapiens ] |
| Official Symbol | ARSE |
| Synonyms | ARSE; arylsulfatase E (chondrodysplasia punctata 1); CDPX, CDPX1; arylsulfatase E; chondrodysplasia punctata 1; ASE; CDPX; CDPX1; CDPXR; MGC163310; |
| mRNA Refseq | NM_000047 |
| Protein Refseq | NP_000038 |
| MIM | 300180 |
| UniProt ID | P51690 |
| Gene ID | 415 |
| ◆ Recombinant Proteins | ||
| ARSE-7877H | Recombinant Human ARSE protein, GST-tagged | +Inquiry |
| ARSE-3661H | Recombinant Human ARSE, His-tagged | +Inquiry |
| ARSE-7878H | Recombinant Human ARSE protein, His-tagged | +Inquiry |
| ARSE-863H | Recombinant Human ARSE protein, GST-tagged | +Inquiry |
| ARSE-2824H | Recombinant Human ARSE Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARSE-38HCL | Recombinant Human ARSE lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSE Products
Required fields are marked with *
My Review for All ARSE Products
Required fields are marked with *
