Recombinant Human ASAH2B Protein (1-165 aa), His-tagged

Cat.No. : ASAH2B-1336H
Product Overview : Recombinant Human ASAH2B Protein (1-165 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-165 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.0 kDa
AA Sequence : MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ASAH2B N-acylsphingosine amidohydrolase 2B [ Homo sapiens (human) ]
Official Symbol ASAH2B
Synonyms ASAH2C; ASAH2L; bA98I6.3; bA449O16.3;
Gene ID 653308
UniProt ID P0C7U1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASAH2B Products

Required fields are marked with *

My Review for All ASAH2B Products

Required fields are marked with *

0
cart-icon