Recombinant Human ASB6 protein, GST-tagged
| Cat.No. : | ASB6-6332H |
| Product Overview : | Recombinant Human ASB6 protein(1-163 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-163 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | ASB6 |
| Synonyms | ASB6; ankyrin repeat and SOCS box containing 6; ankyrin repeat and SOCS box protein 6; ankyrin repeat and SOCS box-containing 6; MGC1024; FLJ20548; |
| Gene ID | 140459 |
| mRNA Refseq | NM_001202403 |
| Protein Refseq | NP_001189332 |
| UniProt ID | Q9NWX5 |
| ◆ Recombinant Proteins | ||
| ASB6-4824H | Recombinant Human ASB6 protein, His-SUMO-tagged | +Inquiry |
| ASB6-6332H | Recombinant Human ASB6 protein, GST-tagged | +Inquiry |
| ASB6-9919H | Recombinant Human ASB6 protein, His-tagged | +Inquiry |
| ASB6-2391C | Recombinant Chicken ASB6 | +Inquiry |
| ASB6-2759Z | Recombinant Zebrafish ASB6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASB6-8661HCL | Recombinant Human ASB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB6 Products
Required fields are marked with *
My Review for All ASB6 Products
Required fields are marked with *
