Recombinant Human ASB6 protein, His-tagged

• Cat.No.: ASB6-9919H
• Product Overview: Recombinant Human ASB6 protein(1-163 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-163 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: ASB6
• Synonyms: ASB6; ankyrin repeat and SOCS box containing 6; ankyrin repeat and SOCS box protein 6; ankyrin repeat and SOCS box-containing 6; MGC1024; FLJ20548
• Gene ID: 140459
• mRNA Refseq: NM_001202403
• Protein Refseq: NP_001189332
• UniProt ID: Q9NWX5