Recombinant Human ASB6 protein, GST-tagged
Cat.No. : | ASB6-895H |
Product Overview : | Human ASB6 full-length ORF ( AAH01719, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 47.41 kDa |
AA Sequence : | MPFLHGFRRIIFEYQPLVDAIPGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASB6 ankyrin repeat and SOCS box containing 6 [ Homo sapiens ] |
Official Symbol | ASB6 |
Synonyms | ASB6; ankyrin repeat and SOCS box containing 6; ankyrin repeat and SOCS box protein 6; ankyrin repeat and SOCS box-containing 6; MGC1024; FLJ20548; |
Gene ID | 140459 |
mRNA Refseq | NM_001202403 |
Protein Refseq | NP_001189332 |
UniProt ID | Q9NWX5 |
◆ Recombinant Proteins | ||
ASB6-2759Z | Recombinant Zebrafish ASB6 | +Inquiry |
ASB6-895H | Recombinant Human ASB6 protein, GST-tagged | +Inquiry |
ASB6-6332H | Recombinant Human ASB6 protein, GST-tagged | +Inquiry |
ASB6-2391C | Recombinant Chicken ASB6 | +Inquiry |
ASB6-4824H | Recombinant Human ASB6 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASB6-8661HCL | Recombinant Human ASB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB6 Products
Required fields are marked with *
My Review for All ASB6 Products
Required fields are marked with *