Recombinant Human ASF1A protein, His/T7-tagged
Cat.No. : | ASF1A-46H |
Product Overview : | Recombinant Human ASF1A(Met1-Met204) fused with a T7 tag at the N-terminus, 6His tag at the C-terminus was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 1-204 a.a. |
Description : | Human Histone Chaperone ASF1A (ASF1A) belongs to the H3/H4 family of histone chaperone proteins. ASF1A is ubiquitously expressed in many cells and tissues, interacting with histones H3 and H4. ASF1A cooperates with Chromatin Assembly Factor 1 to promote replication-dependent chromatin assembly and with HIRA to promote replication-independent chromatin assembly. In addition, ASF1A is necessary for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 150mM NaCl, pH 8.0. |
AA Sequence : | MASMTGGQQMGRGSMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNE YTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPS ASKGWSTSENSLNVMLESHMDCMLEHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ASF1A |
Synonyms | ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146; |
Gene ID | 25842 |
mRNA Refseq | NM_014034 |
Protein Refseq | NP_054753 |
MIM | 609189 |
UniProt ID | Q9Y294 |
Chromosome Location | 6q22.31 |
Function | chromatin binding; histone binding; protein binding; |
◆ Recombinant Proteins | ||
ASF1A-255R | Recombinant Rhesus Macaque ASF1A Protein, His (Fc)-Avi-tagged | +Inquiry |
ASF1A-426R | Recombinant Rhesus monkey ASF1A Protein, His-tagged | +Inquiry |
ASF1A-508H | Recombinant Human ASF1A, His-tagged | +Inquiry |
ASF1A-903H | Recombinant Human ASF1A protein, GST-tagged | +Inquiry |
ASF1A-2028M | Recombinant Mouse ASF1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1A-8653HCL | Recombinant Human ASF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASF1A Products
Required fields are marked with *
My Review for All ASF1A Products
Required fields are marked with *
0
Inquiry Basket