Recombinant Human ASF1B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ASF1B-1336H |
| Product Overview : | ASF1B MS Standard C13 and N15-labeled recombinant protein (NP_060624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. |
| Molecular Mass : | 22.4 kDa |
| AA Sequence : | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ASF1B anti-silencing function 1B histone chaperone [ Homo sapiens (human) ] |
| Official Symbol | ASF1B |
| Synonyms | ASF1B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; FLJ10604; hAsf1; hAsf1b; hCIA-II; CCG1-interacting factor A-II; anti-silencing function protein 1 homolog B; CIA-II; |
| Gene ID | 55723 |
| mRNA Refseq | NM_018154 |
| Protein Refseq | NP_060624 |
| MIM | 609190 |
| UniProt ID | Q9NVP2 |
| ◆ Recombinant Proteins | ||
| ASF1B-9930H | Recombinant Human ASF1B, GST-tagged | +Inquiry |
| ASF1B-788M | Recombinant Mouse ASF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASF1B-2363H | Recombinant Human ASF1B protein, His-tagged | +Inquiry |
| ASF1B-2029M | Recombinant Mouse ASF1B Protein | +Inquiry |
| Asf1b-1742M | Recombinant Mouse Asf1b Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASF1B Products
Required fields are marked with *
My Review for All ASF1B Products
Required fields are marked with *
