Recombinant Human ASH2L Protein (1-534 aa), His-SUMO-tagged
Cat.No. : | ASH2L-1146H |
Product Overview : | Recombinant Human ASH2L Protein (1-534 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Isoform 3. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-534 aa |
Description : | Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May function as a transcriptional regulator. May play a role in hatopoiesis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 76.2 kDa |
AA Sequence : | MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ] |
Official Symbol | ASH2L |
Synonyms | ASH2L; ASH2; ASH2L2; Bre2; ASH2L1; |
Gene ID | 9070 |
mRNA Refseq | NM_001105214 |
Protein Refseq | NP_001098684 |
MIM | 604782 |
UniProt ID | Q9UBL3 |
◆ Recombinant Proteins | ||
ASH2L-159H | Recombinant Human ASH2L Protein, SUMO-tagged | +Inquiry |
Ash2l-1743M | Recombinant Mouse Ash2l Protein, Myc/DDK-tagged | +Inquiry |
ASH2L-6103Z | Recombinant Zebrafish ASH2L | +Inquiry |
ASH2L-1087HF | Recombinant Full Length Human ASH2L Protein, GST-tagged | +Inquiry |
ASH2L-009H | Active Recombinant Human ASH2L Protein, SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASH2L-8652HCL | Recombinant Human ASH2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASH2L Products
Required fields are marked with *
My Review for All ASH2L Products
Required fields are marked with *
0
Inquiry Basket