Recombinant Human ASIP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ASIP-4038H |
Product Overview : | ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. |
Molecular Mass : | 14.52 kDa |
AA Sequence : | MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ASIP agouti signaling protein [ Homo sapiens (human) ] |
Official Symbol | ASIP |
Synonyms | ASIP; agouti signaling protein; ASP; AGSW; AGTI; AGTIL; SHEP9; agouti-signaling protein; agouti signaling protein, nonagouti homolog; agouti switch protein; nonagouti homolog |
Gene ID | 434 |
mRNA Refseq | NM_001672 |
Protein Refseq | NP_001663 |
MIM | 600201 |
UniProt ID | P42127 |
◆ Recombinant Proteins | ||
ASIP-6018H | Recombinant Human ASIP protein(23-132aa), His&Myc-tagged | +Inquiry |
ASIP-389H | Recombinant Human ASIP Protein, His (Fc)-Avi-tagged | +Inquiry |
ASIP-3828C | Recombinant Chicken ASIP | +Inquiry |
ASIP-1930B | Recombinant Bovine ASIP Protein (23-133 aa), His-SUMO-tagged | +Inquiry |
ASIP-018H | Recombinant Human ASIP protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIP-8651HCL | Recombinant Human ASIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASIP Products
Required fields are marked with *
My Review for All ASIP Products
Required fields are marked with *
0
Inquiry Basket