Recombinant Human ASIP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ASIP-4038H
Product Overview : ASIP MS Standard C13 and N15-labeled recombinant protein (NP_001663) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : In mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.
Molecular Mass : 14.52 kDa
AA Sequence : MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ASIP agouti signaling protein [ Homo sapiens (human) ]
Official Symbol ASIP
Synonyms ASIP; agouti signaling protein; ASP; AGSW; AGTI; AGTIL; SHEP9; agouti-signaling protein; agouti signaling protein, nonagouti homolog; agouti switch protein; nonagouti homolog
Gene ID 434
mRNA Refseq NM_001672
Protein Refseq NP_001663
MIM 600201
UniProt ID P42127

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASIP Products

Required fields are marked with *

My Review for All ASIP Products

Required fields are marked with *

0
cart-icon