Recombinant Human ASMT protein, His&Myc-tagged
| Cat.No. : | ASMT-2558H |
| Product Overview : | Recombinant Human ASMT protein(P46597)(1-345aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-345aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.9 kDa |
| AA Sequence : | MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ASMT acetylserotonin O-methyltransferase [ Homo sapiens ] |
| Official Symbol | ASMT |
| Synonyms | ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome); |
| Gene ID | 438 |
| mRNA Refseq | NM_001171038 |
| Protein Refseq | NP_001164509 |
| MIM | 300015 |
| UniProt ID | P46597 |
| ◆ Recombinant Proteins | ||
| ASMT-6495Z | Recombinant Zebrafish ASMT | +Inquiry |
| ASMT-350H | Recombinant Human acetylserotonin O-methyltransferase, His-tagged | +Inquiry |
| ASMT-1023HF | Recombinant Full Length Human ASMT Protein, GST-tagged | +Inquiry |
| Asmt-3062M | Recombinant Mouse Asmt, His-tagged | +Inquiry |
| ASMT-3063H | Recombinant Human ASMT, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASMT-41HCL | Recombinant Human ASMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASMT Products
Required fields are marked with *
My Review for All ASMT Products
Required fields are marked with *
