Recombinant Human ASMT protein, His&Myc-tagged
Cat.No. : | ASMT-2558H |
Product Overview : | Recombinant Human ASMT protein(P46597)(1-345aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-345aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ASMT acetylserotonin O-methyltransferase [ Homo sapiens ] |
Official Symbol | ASMT |
Synonyms | ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome); |
Gene ID | 438 |
mRNA Refseq | NM_001171038 |
Protein Refseq | NP_001164509 |
MIM | 300015 |
UniProt ID | P46597 |
◆ Recombinant Proteins | ||
ASMT-1023HF | Recombinant Full Length Human ASMT Protein, GST-tagged | +Inquiry |
ASMT-2558H | Recombinant Human ASMT protein, His&Myc-tagged | +Inquiry |
ASMT-6495Z | Recombinant Zebrafish ASMT | +Inquiry |
ASMT-911H | Recombinant Human ASMT protein, GST-tagged | +Inquiry |
ASMT-483R | Recombinant Rat ASMT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASMT-41HCL | Recombinant Human ASMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASMT Products
Required fields are marked with *
My Review for All ASMT Products
Required fields are marked with *
0
Inquiry Basket