Recombinant Human ASPA protein, His&Myc-tagged
| Cat.No. : | ASPA-2560H |
| Product Overview : | Recombinant Human ASPA protein(P45381)(1-313aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-313aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ASPA aspartoacylase [ Homo sapiens ] |
| Official Symbol | ASPA |
| Synonyms | ASPA; aspartoacylase; aspartoacylase (aminoacylase 2, Canavan disease); ACY2; aminoacylase 2; ASP; Canavan disease; ACY-2; aminoacylase-2; |
| Gene ID | 443 |
| mRNA Refseq | NM_000049 |
| Protein Refseq | NP_000040 |
| MIM | 608034 |
| UniProt ID | P45381 |
| ◆ Recombinant Proteins | ||
| ASPA-67C | Recombinant Cynomolgus Monkey ASPA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASPA-829R | Recombinant Rat ASPA Protein | +Inquiry |
| Aspa-253M | Recombinant Mouse Aspa Protein, His-tagged | +Inquiry |
| ASPA-430R | Recombinant Rhesus monkey ASPA Protein, His-tagged | +Inquiry |
| ASPA-252H | Recombinant Human ASPA Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASPA-8647HCL | Recombinant Human ASPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASPA Products
Required fields are marked with *
My Review for All ASPA Products
Required fields are marked with *
