Recombinant Human ASRGL1 protein, GST-tagged
Cat.No. : | ASRGL1-921H |
Product Overview : | Human ASRGL1 full-length ORF ( AAH64963, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ASRGL1 (Asparaginase Like 1) is a Protein Coding gene. Among its related pathways are Metabolism and Histidine, lysine, phenylalanine, tyrosine, proline and tryptophan catabolism. GO annotations related to this gene include hydrolase activity and asparaginase activity. An important paralog of this gene is TASP1. |
Molecular Mass : | 45.54 kDa |
AA Sequence : | MGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASRGL1 asparaginase like 1 [ Homo sapiens (human) ] |
Official Symbol | ASRGL1 |
Synonyms | ASRGL1; asparaginase like 1; ALP; ALP1; CRASH; isoaspartyl peptidase/L-asparaginase; L-asparaginase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1; beta-aspartyl-peptidase; isoaspartyl dipeptidase; testis secretory sperm-binding protein Li 242mP; EC 3.4.19.5; EC 3.5.1.1 |
Gene ID | 114242 |
mRNA Refseq | NM_001083926 |
Protein Refseq | NP_001077395 |
MIM | 609212 |
UniProt ID | Q7L266 |
◆ Recombinant Proteins | ||
ASRGL1-432R | Recombinant Rhesus monkey ASRGL1 Protein, His-tagged | +Inquiry |
ASRGL1-921H | Recombinant Human ASRGL1 protein, GST-tagged | +Inquiry |
ASRGL1-666H | Recombinant Human asparaginase like 1, His-tagged | +Inquiry |
ASRGL1-318C | Recombinant Cynomolgus ASRGL1 Protein, His-tagged | +Inquiry |
ASRGL1-2930H | Recombinant Human ASRGL1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASRGL1-140HCL | Recombinant Human ASRGL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASRGL1 Products
Required fields are marked with *
My Review for All ASRGL1 Products
Required fields are marked with *