Recombinant Human ASRGL1 protein, GST-tagged
Cat.No. : | ASRGL1-1870H |
Product Overview : | Recombinant Human ASRGL1 protein(1-308 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-308 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ASRGL1[ Homo sapiens ] |
Official Symbol | ASRGL1 |
Synonyms | ASRGL1; ALP; ALP1; asparaginase like 1 protein; FLJ22316; |
Gene ID | 114242 |
MIM | 609212 |
UniProt ID | Q7L266 |
◆ Recombinant Proteins | ||
ASRGL1-488R | Recombinant Rat ASRGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Asrgl1-1753M | Recombinant Mouse Asrgl1 Protein, Myc/DDK-tagged | +Inquiry |
ASRGL1-1870H | Recombinant Human ASRGL1 protein, GST-tagged | +Inquiry |
ASRGL1-2930H | Recombinant Human ASRGL1 Protein, MYC/DDK-tagged | +Inquiry |
ASRGL1-832R | Recombinant Rat ASRGL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASRGL1-140HCL | Recombinant Human ASRGL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASRGL1 Products
Required fields are marked with *
My Review for All ASRGL1 Products
Required fields are marked with *
0
Inquiry Basket