Recombinant Human ASRGL1 therapeutic protein(Pegaspargase)

Cat.No. : ASRGL1-P040H
Product Overview : Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life. It is a modified enzyme used as an antineoplastic agent. It is a form of L-asparaginase which has undergone PEGylation. It is used in the treatment of acute lymphoblastic leukemia.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Recombinant Human L-asparaginase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.
Molecular Mass : 31.7 kDa
AA Sequence : MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNAVPQLKDIANVK GEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTS MSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQR TPARKHTSDTPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAK TGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY
Endotoxin : < 0.1 EU per μg of the protein
Purity : >95%
Alias : ALP; ALP1; CRASH; Peg-asparaginase; Pegaspargase
Gene Name ASRGL1 asparaginase like 1 [ Homo sapiens ]
Official Symbol ASRGL1
Synonyms ALP; ALP1; CRASH; L-asparaginase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1; beta-aspartyl-peptidase; isoaspartyl dipeptidase; testis secretory sperm-binding protein Li 242mP
Gene ID 80150
mRNA Refseq NM_001083926
Protein Refseq NP_001077395
MIM 609212
UniProt ID Q7L266
Chromosome Location 11q12.3
Pathway Histidine, lysine, phenylalanine, tyrosine, proline and tryptophan catabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem
Function NOT N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity; asparaginase activity; beta-aspartyl-peptidase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASRGL1 Products

Required fields are marked with *

My Review for All ASRGL1 Products

Required fields are marked with *

0
cart-icon