Recombinant Human ASRGL1 therapeutic protein(Pegaspargase)
| Cat.No. : | ASRGL1-P040H |
| Product Overview : | Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life. It is a modified enzyme used as an antineoplastic agent. It is a form of L-asparaginase which has undergone PEGylation. It is used in the treatment of acute lymphoblastic leukemia. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | Recombinant Human L-asparaginase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNAVPQLKDIANVK GEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYFLDLTVKCDKPVVMVGAMRPSTS MSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQR TPARKHTSDTPFDVSKLNELPKVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAK TGTAVVRSSRVPTGATTQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY |
| Endotoxin : | < 0.1 EU per μg of the protein |
| Purity : | >95% |
| Alias : | ALP; ALP1; CRASH; Peg-asparaginase; Pegaspargase |
| Gene Name | ASRGL1 asparaginase like 1 [ Homo sapiens ] |
| Official Symbol | ASRGL1 |
| Synonyms | ALP; ALP1; CRASH; L-asparaginase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1; beta-aspartyl-peptidase; isoaspartyl dipeptidase; testis secretory sperm-binding protein Li 242mP |
| Gene ID | 80150 |
| mRNA Refseq | NM_001083926 |
| Protein Refseq | NP_001077395 |
| MIM | 609212 |
| UniProt ID | Q7L266 |
| Chromosome Location | 11q12.3 |
| Pathway | Histidine, lysine, phenylalanine, tyrosine, proline and tryptophan catabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem |
| Function | NOT N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity; asparaginase activity; beta-aspartyl-peptidase activity |
| ◆ Recombinant Proteins | ||
| ASRGL1-832R | Recombinant Rat ASRGL1 Protein | +Inquiry |
| ASRGL1-68C | Recombinant Cynomolgus Monkey ASRGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASRGL1-261R | Recombinant Rhesus Macaque ASRGL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASRGL1-2930H | Recombinant Human ASRGL1 Protein, MYC/DDK-tagged | +Inquiry |
| ASRGL1-432R | Recombinant Rhesus monkey ASRGL1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASRGL1-140HCL | Recombinant Human ASRGL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASRGL1 Products
Required fields are marked with *
My Review for All ASRGL1 Products
Required fields are marked with *
