Recombinant Human ATAD1 protein, GST-tagged

• Cat.No.: ATAD1-929H
• Product Overview: Human ATAD1 full-length ORF ( AAH10868.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ATAD1 (ATPase Family, AAA Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include ATPase activity and microtubule-severing ATPase activity.
• Molecular Mass: 43.7 kDa
• AA Sequence: MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATAD1 ATPase family, AAA domain containing 1 [ Homo sapiens ]
• Official Symbol: ATAD1
• Synonyms: ATAD1; ATPase family, AAA domain containing 1; ATPase family AAA domain-containing protein 1; FLJ14600; AFDC1; FNP001; THORASE
• Gene ID: 84896
• mRNA Refseq: NM_032810
• Protein Refseq: NP_116199
• MIM: 614452
• UniProt ID: Q8NBU5