Recombinant Human ATAD1 protein, GST-tagged
| Cat.No. : | ATAD1-929H |
| Product Overview : | Human ATAD1 full-length ORF ( AAH10868.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ATAD1 (ATPase Family, AAA Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include ATPase activity and microtubule-severing ATPase activity. |
| Molecular Mass : | 43.7 kDa |
| AA Sequence : | MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATAD1 ATPase family, AAA domain containing 1 [ Homo sapiens ] |
| Official Symbol | ATAD1 |
| Synonyms | ATAD1; ATPase family, AAA domain containing 1; ATPase family AAA domain-containing protein 1; FLJ14600; AFDC1; FNP001; THORASE; |
| Gene ID | 84896 |
| mRNA Refseq | NM_032810 |
| Protein Refseq | NP_116199 |
| MIM | 614452 |
| UniProt ID | Q8NBU5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATAD1 Products
Required fields are marked with *
My Review for All ATAD1 Products
Required fields are marked with *
