Recombinant Human ATAD1 protein, GST-tagged
Cat.No. : | ATAD1-929H |
Product Overview : | Human ATAD1 full-length ORF ( AAH10868.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ATAD1 (ATPase Family, AAA Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include ATPase activity and microtubule-severing ATPase activity. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTHVCLD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATAD1 ATPase family, AAA domain containing 1 [ Homo sapiens ] |
Official Symbol | ATAD1 |
Synonyms | ATAD1; ATPase family, AAA domain containing 1; ATPase family AAA domain-containing protein 1; FLJ14600; AFDC1; FNP001; THORASE; |
Gene ID | 84896 |
mRNA Refseq | NM_032810 |
Protein Refseq | NP_116199 |
MIM | 614452 |
UniProt ID | Q8NBU5 |
◆ Recombinant Proteins | ||
ATAD1-490R | Recombinant Rat ATAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATAD1-263R | Recombinant Rhesus Macaque ATAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATAD1-808M | Recombinant Mouse ATAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATAD1-1491HF | Recombinant Full Length Human ATAD1 Protein, GST-tagged | +Inquiry |
ATAD1-3762B | Recombinant Bovine ATAD1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATAD1-44HCL | Recombinant Human ATAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATAD1 Products
Required fields are marked with *
My Review for All ATAD1 Products
Required fields are marked with *