Recombinant Human ATF6B
Cat.No. : | ATF6B-26189TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2-88 of Human ATF6 beta, with an N-terminal proprietary tag, predicted MWt 35.2 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 87 amino acids |
Description : | The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 35.200kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
Sequence Similarities : | Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain. |
Gene Name | ATF6B activating transcription factor 6 beta [ Homo sapiens ] |
Official Symbol | ATF6B |
Synonyms | ATF6B; activating transcription factor 6 beta; cAMP responsive element binding protein like 1 , CREBL1; cyclic AMP-dependent transcription factor ATF-6 beta; G13; |
Gene ID | 1388 |
mRNA Refseq | NM_001136153 |
Protein Refseq | NP_001129625 |
MIM | 600984 |
Uniprot ID | Q99941 |
Chromosome Location | 6p21.3 |
Pathway | Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; G1 to S cell cycle control, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; |
Function | protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ATF6B-4821Z | Recombinant Zebrafish ATF6B | +Inquiry |
ATF6B-26100TH | Recombinant Human ATF6B Protein, GST-tagged | +Inquiry |
ATF6B-816M | Recombinant Mouse ATF6B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF6B-2070M | Recombinant Mouse ATF6B Protein | +Inquiry |
ATF6B-26189TH | Recombinant Human ATF6B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF6B Products
Required fields are marked with *
My Review for All ATF6B Products
Required fields are marked with *