Recombinant Human ATF6B

• Cat.No.: ATF6B-26189TH
• Product Overview: Recombinant fragment, corresponding to amino acids 2-88 of Human ATF6 beta, with an N-terminal proprietary tag, predicted MWt 35.2 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 87 amino acids
• Description: The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 35.200kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
• Sequence Similarities: Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain.

Gene Information

• Gene Name: ATF6B activating transcription factor 6 beta [ Homo sapiens ]
• Official Symbol: ATF6B
• Synonyms: ATF6B; activating transcription factor 6 beta; cAMP responsive element binding protein like 1 , CREBL1; cyclic AMP-dependent transcription factor ATF-6 beta; G13
• Gene ID: 1388
• mRNA Refseq: NM_001136153
• Protein Refseq: NP_001129625
• MIM: 600984
• Uniprot ID: Q99941
• Chromosome Location: 6p21.3
• Pathway: Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; G1 to S cell cycle control, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem
• Function: protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity