Recombinant Human ATG4D protein, GST-tagged ATG4D-431H

Recombinant Human ATG4D protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ATG4D protein, GST-tagged

Recombinant Human ATG4D protein, GST-tagged

ATG4D Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ATG4D-431H
Product Overview : Recombinant Human ATG4D(1 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 42.4 kDa
Protein length : 1 a.a. - 141 a.a.
AA Sequence : MGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETL CSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) [ Homo sapiens ]
Official Symbol : ATG4D
Synonyms : ATG4D; ATG4 autophagy related 4 homolog D (S. cerevisiae); APG4 autophagy 4 homolog D (S. cerevisiae) , APG4D, AUT like 4, cysteine endopeptidase (S. cerevisiae) , AUTL4; cysteine protease ATG4D; APG4 D; autophagin-4; APG4 autophagy 4 homolog D; AUT-like 4 cysteine endopeptidase; AUT-like 4, cysteine endopeptidase; autophagy-related protein 4 homolog D; cysteine protease involved in autophagy; autophagy-related cysteine endopeptidase 4; APG4D; AUTL4; APG4-D;
Gene ID : 84971
mRNA Refseq : NM_032885
Protein Refseq : NP_116274
MIM : 611340
UniProt ID : Q86TL0
Chromosome Location : 19p13.2
Pathway : Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem;
Function : cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy