Recombinant Human ATG4D protein, GST-tagged

Cat.No. : ATG4D-431H
Product Overview : Recombinant Human ATG4D(1 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 141 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 42.4 kDa
AA Sequence : MGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETL CSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG4D
Synonyms ATG4D; ATG4 autophagy related 4 homolog D (S. cerevisiae); APG4 autophagy 4 homolog D (S. cerevisiae) , APG4D, AUT like 4, cysteine endopeptidase (S. cerevisiae) , AUTL4; cysteine protease ATG4D; APG4 D; autophagin-4; APG4 autophagy 4 homolog D; AUT-like 4 cysteine endopeptidase; AUT-like 4, cysteine endopeptidase; autophagy-related protein 4 homolog D; cysteine protease involved in autophagy; autophagy-related cysteine endopeptidase 4; APG4D; AUTL4; APG4-D;
Gene ID 84971
mRNA Refseq NM_032885
Protein Refseq NP_116274
MIM 611340
UniProt ID Q86TL0
Chromosome Location 19p13.2
Pathway Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem;
Function cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG4D Products

Required fields are marked with *

My Review for All ATG4D Products

Required fields are marked with *

0
cart-icon