Recombinant Human ATG4D protein, GST-tagged
Cat.No. : | ATG4D-431H |
Product Overview : | Recombinant Human ATG4D(1 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 141 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 42.4 kDa |
AA Sequence : | MGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETL CSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG4D |
Synonyms | ATG4D; ATG4 autophagy related 4 homolog D (S. cerevisiae); APG4 autophagy 4 homolog D (S. cerevisiae) , APG4D, AUT like 4, cysteine endopeptidase (S. cerevisiae) , AUTL4; cysteine protease ATG4D; APG4 D; autophagin-4; APG4 autophagy 4 homolog D; AUT-like 4 cysteine endopeptidase; AUT-like 4, cysteine endopeptidase; autophagy-related protein 4 homolog D; cysteine protease involved in autophagy; autophagy-related cysteine endopeptidase 4; APG4D; AUTL4; APG4-D; |
Gene ID | 84971 |
mRNA Refseq | NM_032885 |
Protein Refseq | NP_116274 |
MIM | 611340 |
UniProt ID | Q86TL0 |
Chromosome Location | 19p13.2 |
Pathway | Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; |
Function | cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
ATG4D-827M | Recombinant Mouse ATG4D Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG4D-9977H | Recombinant Human ATG4D, His-tagged | +Inquiry |
ATG4D-431H | Recombinant Human ATG4D protein, GST-tagged | +Inquiry |
ATG4D-2084M | Recombinant Mouse ATG4D Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG4D-45HCL | Recombinant Human ATG4D lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG4D Products
Required fields are marked with *
My Review for All ATG4D Products
Required fields are marked with *
0
Inquiry Basket