Recombinant Human ATG4D protein, GST-tagged
| Cat.No. : | ATG4D-431H |
| Product Overview : | Recombinant Human ATG4D(1 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 141 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 42.4 kDa |
| AA Sequence : | MGGKPRHSLYFIGYQDDFLLYLDPHYCQPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETL CSELTRVLSSSSATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ATG4D ATG4 autophagy related 4 homolog D (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ATG4D |
| Synonyms | ATG4D; ATG4 autophagy related 4 homolog D (S. cerevisiae); APG4 autophagy 4 homolog D (S. cerevisiae) , APG4D, AUT like 4, cysteine endopeptidase (S. cerevisiae) , AUTL4; cysteine protease ATG4D; APG4 D; autophagin-4; APG4 autophagy 4 homolog D; AUT-like 4 cysteine endopeptidase; AUT-like 4, cysteine endopeptidase; autophagy-related protein 4 homolog D; cysteine protease involved in autophagy; autophagy-related cysteine endopeptidase 4; APG4D; AUTL4; APG4-D; |
| Gene ID | 84971 |
| mRNA Refseq | NM_032885 |
| Protein Refseq | NP_116274 |
| MIM | 611340 |
| UniProt ID | Q86TL0 |
| Chromosome Location | 19p13.2 |
| Pathway | Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; |
| Function | cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG4D Products
Required fields are marked with *
My Review for All ATG4D Products
Required fields are marked with *
