Recombinant Human ATN1 protein, GST-tagged

• Cat.No.: ATN1-955H
• Product Overview: Human ATN1 partial ORF ( AAH51795, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Dentatorubral pallidoluysian atrophy (DRPLA) is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion from 7-35 copies to 49-93 copies of a trinucleotide repeat (CAG/CAA) within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein. [provided by RefSeq, Jul 2016]
• Molecular Mass: 37.84 kDa
• AA Sequence: MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATN1 atrophin 1 [ Homo sapiens ]
• Official Symbol: ATN1
• Synonyms: ATN1; atrophin 1; D12S755E, dentatorubral pallidoluysian atrophy (atrophin 1) , DRPLA; atrophin-1; B37; dentatorubral-pallidoluysian atrophy protein; HRS; NOD; DRPLA; D12S755E
• Gene ID: 1822
• mRNA Refseq: NM_001007026
• Protein Refseq: NP_001007027
• MIM: 607462
• UniProt ID: P54259