Recombinant Human ATN1 protein, GST-tagged
| Cat.No. : | ATN1-955H |
| Product Overview : | Human ATN1 partial ORF ( AAH51795, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Dentatorubral pallidoluysian atrophy (DRPLA) is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion from 7-35 copies to 49-93 copies of a trinucleotide repeat (CAG/CAA) within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein. [provided by RefSeq, Jul 2016] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDG |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATN1 atrophin 1 [ Homo sapiens ] |
| Official Symbol | ATN1 |
| Synonyms | ATN1; atrophin 1; D12S755E, dentatorubral pallidoluysian atrophy (atrophin 1) , DRPLA; atrophin-1; B37; dentatorubral-pallidoluysian atrophy protein; HRS; NOD; DRPLA; D12S755E; |
| Gene ID | 1822 |
| mRNA Refseq | NM_001007026 |
| Protein Refseq | NP_001007027 |
| MIM | 607462 |
| UniProt ID | P54259 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATN1 Products
Required fields are marked with *
My Review for All ATN1 Products
Required fields are marked with *



