Recombinant Human ATN1 protein, GST-tagged

Cat.No. : ATN1-955H
Product Overview : Human ATN1 partial ORF ( AAH51795, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Dentatorubral pallidoluysian atrophy (DRPLA) is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion from 7-35 copies to 49-93 copies of a trinucleotide repeat (CAG/CAA) within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein. [provided by RefSeq, Jul 2016]
Molecular Mass : 37.84 kDa
AA Sequence : MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVEEASTPKVNKQGRSEEISESESEETNAPKKTKTEQELPRPQSPSDLDSLDG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATN1 atrophin 1 [ Homo sapiens ]
Official Symbol ATN1
Synonyms ATN1; atrophin 1; D12S755E, dentatorubral pallidoluysian atrophy (atrophin 1) , DRPLA; atrophin-1; B37; dentatorubral-pallidoluysian atrophy protein; HRS; NOD; DRPLA; D12S755E;
Gene ID 1822
mRNA Refseq NM_001007026
Protein Refseq NP_001007027
MIM 607462
UniProt ID P54259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATN1 Products

Required fields are marked with *

My Review for All ATN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon