Recombinant Human ATOH1 Protein (1-354 aa), His-tagged
Cat.No. : | ATOH1-1809H |
Product Overview : | Recombinant Human ATOH1 Protein (1-354 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-354 aa |
Description : | Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ATOH1 atonal homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | ATOH1 |
Synonyms | ATOH1; bHLHa14; HATH1; MATH 1; Math1; ATH1; MATH-1; |
Gene ID | 474 |
mRNA Refseq | NM_005172 |
Protein Refseq | NP_005163 |
MIM | 601461 |
UniProt ID | Q92858 |
◆ Recombinant Proteins | ||
ATOH1-4698H | Recombinant Human ATOH1 protein, His-SUMO-tagged | +Inquiry |
ATOH1-369H | Recombinant Human ATOH1 protein | +Inquiry |
ATOH1-582HF | Recombinant Full Length Human ATOH1 Protein, GST-tagged | +Inquiry |
ATOH1-368H | Recombinant Human ATOH1 protein, His-tagged | +Inquiry |
ATOH1-1809H | Recombinant Human ATOH1 Protein (1-354 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOH1-8617HCL | Recombinant Human ATOH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATOH1 Products
Required fields are marked with *
My Review for All ATOH1 Products
Required fields are marked with *
0
Inquiry Basket