Recombinant Human ATOH1 protein, GST-tagged
Cat.No. : | ATOH1-367H |
Product Overview : | Recombinant Human ATOH1(1 a.a. - 354 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-354 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 64.6 kDa |
AA Sequence : | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTA RAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSS KQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPP PPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ATOH1 atonal homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | ATOH1 |
Synonyms | ATOH1; atonal homolog 1 (Drosophila); protein atonal homolog 1; bHLHa14; HATH1; MATH 1; Math1; helix-loop-helix protein hATH-1; class A basic helix-loop-helix protein 14; ATH1; MATH-1; |
Gene ID | 474 |
mRNA Refseq | NM_005172 |
Protein Refseq | NP_005163 |
MIM | 601461 |
UniProt ID | Q92858 |
Chromosome Location | 4q22 |
Function | chromatin DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ATOH1-837M | Recombinant Mouse ATOH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATOH1-1809H | Recombinant Human ATOH1 Protein (1-354 aa), His-tagged | +Inquiry |
ATOH1-582HF | Recombinant Full Length Human ATOH1 Protein, GST-tagged | +Inquiry |
ATOH1-4698H | Recombinant Human ATOH1 protein, His-SUMO-tagged | +Inquiry |
ATOH1-368H | Recombinant Human ATOH1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATOH1-8617HCL | Recombinant Human ATOH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATOH1 Products
Required fields are marked with *
My Review for All ATOH1 Products
Required fields are marked with *
0
Inquiry Basket