Recombinant Human ATOH1 protein, GST-tagged
| Cat.No. : | ATOH1-367H |
| Product Overview : | Recombinant Human ATOH1(1 a.a. - 354 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-354 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 64.6 kDa |
| AA Sequence : | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTA RAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSS KQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPP PPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDS ALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ATOH1 atonal homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | ATOH1 |
| Synonyms | ATOH1; atonal homolog 1 (Drosophila); protein atonal homolog 1; bHLHa14; HATH1; MATH 1; Math1; helix-loop-helix protein hATH-1; class A basic helix-loop-helix protein 14; ATH1; MATH-1; |
| Gene ID | 474 |
| mRNA Refseq | NM_005172 |
| Protein Refseq | NP_005163 |
| MIM | 601461 |
| UniProt ID | Q92858 |
| Chromosome Location | 4q22 |
| Function | chromatin DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATOH1 Products
Required fields are marked with *
My Review for All ATOH1 Products
Required fields are marked with *



