Recombinant Human ATOH1 protein, His-tagged

Cat.No. : ATOH1-3202H
Product Overview : Recombinant Human ATOH1 protein(1-354 aa), fused to His tag, was expressed in E. coli.
Availability January 14, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-354 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ATOH1 atonal homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol ATOH1
Synonyms ATOH1; atonal homolog 1 (Drosophila); protein atonal homolog 1; bHLHa14; HATH1; MATH 1; Math1; helix-loop-helix protein hATH-1; class A basic helix-loop-helix protein 14; ATH1; MATH-1;
Gene ID 474
mRNA Refseq NM_005172
Protein Refseq NP_005163
MIM 601461
UniProt ID Q92858

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATOH1 Products

Required fields are marked with *

My Review for All ATOH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon