Recombinant Human ATOH7 protein, GST-tagged
| Cat.No. : | ATOH7-956H |
| Product Overview : | Human ATOH7 full-length ORF (AAH32621.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This intronless gene encodes a member of the basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest that this gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations in this gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011] |
| Molecular Mass : | 43.12 kDa |
| AA Sequence : | MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATOH7 atonal homolog 7 (Drosophila) [ Homo sapiens ] |
| Official Symbol | ATOH7 |
| Synonyms | ATOH7; atonal homolog 7 (Drosophila); protein atonal homolog 7; bHLHa13; Math5; hATH5; helix-loop-helix protein hATH-5; class A basic helix-loop-helix protein 13; |
| Gene ID | 220202 |
| mRNA Refseq | NM_145178 |
| Protein Refseq | NP_660161 |
| MIM | 609875 |
| UniProt ID | Q8N100 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATOH7 Products
Required fields are marked with *
My Review for All ATOH7 Products
Required fields are marked with *
