Recombinant Human ATOH7 protein, GST-tagged

Cat.No. : ATOH7-956H
Product Overview : Human ATOH7 full-length ORF (AAH32621.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This intronless gene encodes a member of the basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest that this gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations in this gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011]
Molecular Mass : 43.12 kDa
AA Sequence : MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATOH7 atonal homolog 7 (Drosophila) [ Homo sapiens ]
Official Symbol ATOH7
Synonyms ATOH7; atonal homolog 7 (Drosophila); protein atonal homolog 7; bHLHa13; Math5; hATH5; helix-loop-helix protein hATH-5; class A basic helix-loop-helix protein 13;
Gene ID 220202
mRNA Refseq NM_145178
Protein Refseq NP_660161
MIM 609875
UniProt ID Q8N100

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATOH7 Products

Required fields are marked with *

My Review for All ATOH7 Products

Required fields are marked with *

0
cart-icon
0
compare icon