Recombinant Human ATP11AUN Protein, GST-tagged

Cat.No. : ATP11AUN-529H
Product Overview : Human C13orf35 full-length ORF (BAC85256.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.71 kDa
AA Sequence : MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTYKGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP11AUN ATP11A upstream neighbor [ Homo sapiens (human) ]
Official Symbol ATP11AUN
Synonyms SMABLO1; C13orf35
Gene ID 400165
mRNA Refseq NM_207440.2
Protein Refseq NP_997323.1
UniProt ID Q6ZP68.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP11AUN Products

Required fields are marked with *

My Review for All ATP11AUN Products

Required fields are marked with *

0
cart-icon