Recombinant Human ATP11AUN Protein, GST-tagged

• Cat.No.: ATP11AUN-529H
• Product Overview: Human C13orf35 full-length ORF (BAC85256.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.71 kDa
• AA Sequence: MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTYKGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP11AUN ATP11A upstream neighbor [ Homo sapiens (human) ]
• Official Symbol: ATP11AUN
• Synonyms: SMABLO1; C13orf35
• Gene ID: 400165
• mRNA Refseq: NM_207440.2
• Protein Refseq: NP_997323.1
• UniProt ID: Q6ZP68.1