Recombinant Full Length Human ATP11AUN Protein, GST-tagged
| Cat.No. : | ATP11AUN-1780HF |
| Product Overview : | Human C13orf35 full-length ORF (BAC85256.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 121 amino acids |
| Description : | ATP11AUN (ATP11A Upstream Neighbor LncRNA) is an RNA Gene, and is affiliated with the lncRNA class. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.71 kDa |
| AA Sequence : | MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTYKGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP11AUN ATP11A upstream neighbor [ Homo sapiens (human) ] |
| Official Symbol | ATP11AUN |
| Synonyms | SMABLO1; C13orf35 |
| Gene ID | 400165 |
| mRNA Refseq | NM_207440.2 |
| Protein Refseq | NP_997323.1 |
| UniProt ID | Q6ZP68 |
| ◆ Recombinant Proteins | ||
| ATP11AUN-1780HF | Recombinant Full Length Human ATP11AUN Protein, GST-tagged | +Inquiry |
| ATP11AUN-529H | Recombinant Human ATP11AUN Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP11AUN Products
Required fields are marked with *
My Review for All ATP11AUN Products
Required fields are marked with *



