Recombinant Human ATP11B protein, GST-tagged
Cat.No. : | ATP11B-959H |
Product Overview : | Human ATP11B partial ORF ( NP_055431, 1087 a.a. - 1177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM, Feb 2005] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP11B ATPase, class VI, type 11B [ Homo sapiens ] |
Official Symbol | ATP11B |
Synonyms | ATP11B; ATPase, class VI, type 11B; ATPase, Class VI, type 11B; probable phospholipid-transporting ATPase IF; ATPIF; ATPIR; KIAA0956; ATPase IR; MGC46576; DKFZp434J238; DKFZp434N1615; |
Gene ID | 23200 |
mRNA Refseq | NM_014616 |
Protein Refseq | NP_055431 |
MIM | 605869 |
UniProt ID | Q9Y2G3 |
◆ Recombinant Proteins | ||
ATP11B-959H | Recombinant Human ATP11B protein, GST-tagged | +Inquiry |
ATP11B-262H | Recombinant Human ATP11B Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP11B Products
Required fields are marked with *
My Review for All ATP11B Products
Required fields are marked with *