Recombinant Human ATP11B protein, GST-tagged

• Cat.No.: ATP11B-959H
• Product Overview: Human ATP11B partial ORF ( NP_055431, 1087 a.a. - 1177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM, Feb 2005]
• Molecular Mass: 35.75 kDa
• AA Sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP11B ATPase, class VI, type 11B [ Homo sapiens ]
• Official Symbol: ATP11B
• Synonyms: ATP11B; ATPase, class VI, type 11B; ATPase, Class VI, type 11B; probable phospholipid-transporting ATPase IF; ATPIF; ATPIR; KIAA0956; ATPase IR; MGC46576; DKFZp434J238; DKFZp434N1615
• Gene ID: 23200
• mRNA Refseq: NM_014616
• Protein Refseq: NP_055431
• MIM: 605869
• UniProt ID: Q9Y2G3