Recombinant Human ATP11B protein, GST-tagged

Cat.No. : ATP11B-959H
Product Overview : Human ATP11B partial ORF ( NP_055431, 1087 a.a. - 1177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM, Feb 2005]
Molecular Mass : 35.75 kDa
AA Sequence : DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP11B ATPase, class VI, type 11B [ Homo sapiens ]
Official Symbol ATP11B
Synonyms ATP11B; ATPase, class VI, type 11B; ATPase, Class VI, type 11B; probable phospholipid-transporting ATPase IF; ATPIF; ATPIR; KIAA0956; ATPase IR; MGC46576; DKFZp434J238; DKFZp434N1615;
Gene ID 23200
mRNA Refseq NM_014616
Protein Refseq NP_055431
MIM 605869
UniProt ID Q9Y2G3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP11B Products

Required fields are marked with *

My Review for All ATP11B Products

Required fields are marked with *

0
cart-icon