Recombinant Human ATP1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ATP1B2-2069H
• Product Overview: ATP1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001669) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 33.4 kDa
• AA Sequence: MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ATP1B2 ATPase Na+/K+ transporting subunit beta 2 [ Homo sapiens (human) ]
• Official Symbol: ATP1B2
• Synonyms: ATP1B2; ATPase, Na+/K+ transporting, beta 2 polypeptide; sodium/potassium-transporting ATPase subunit beta-2; AMOG; adhesion molecule on glia; Na, K-ATPase beta-2 polypeptide; sodium/potassium-dependent ATPase beta-2 subunit; sodium/potassium-dependent ATPase subunit beta-2; sodium/potassium-transporting ATPase beta-2 chain
• Gene ID: 482
• mRNA Refseq: NM_001678
• Protein Refseq: NP_001669
• MIM: 182331
• UniProt ID: P14415