Recombinant Human ATP5D, His-tagged
| Cat.No. : | ATP5D-27063TH |
| Product Overview : | Recombinant full length Human ATP5D with N terminal His tag; 167 amino acids including tag, MWt 17.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 146 amino acids |
| Description : | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. |
| Conjugation : | HIS |
| Molecular Weight : | 17.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE |
| Sequence Similarities : | Belongs to the ATPase epsilon chain family. |
| Gene Name | ATP5D ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit [ Homo sapiens ] |
| Official Symbol | ATP5D |
| Synonyms | ATP5D; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; ATP synthase subunit delta, mitochondrial; |
| Gene ID | 513 |
| mRNA Refseq | NM_001001975 |
| Protein Refseq | NP_001001975 |
| MIM | 603150 |
| Uniprot ID | P30049 |
| Chromosome Location | 19p13.3 |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; |
| Function | contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; protein complex binding; |
| ◆ Recombinant Proteins | ||
| ATP5D-2569H | Recombinant Human ATP5D protein, His-SUMO-tagged | +Inquiry |
| ATP5D-3572H | Recombinant Human ATP5D protein, His-tagged | +Inquiry |
| ATP5D-869R | Recombinant Rat ATP5D Protein | +Inquiry |
| ATP5D-283R | Recombinant Rhesus Macaque ATP5D Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5D-1338H | Recombinant Human ATP5D Protein (23-168 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5D-49HCL | Recombinant Human ATP5D lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5D Products
Required fields are marked with *
My Review for All ATP5D Products
Required fields are marked with *



