Recombinant Human ATP5G1, GST-tagged
| Cat.No. : | ATP5G1-48H |
| Product Overview : | Recombinant Human ATP5G1(18 a.a. - 136 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified. |
| Molecular Mass : | 38.83 kDa |
| AA Sequence : | TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGS LIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP5G1 ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [ Homo sapiens ] |
| Official Symbol | ATP5G1 |
| Synonyms | ATP5G1; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 , ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) , ATP5G; ATP synthase lipid-binding protein, mitochondrial; ATPase protein 9; ATPase subunit 9; ATPase subunit C; ATP synthase proteolipid P1; mitochondrial ATP synthase, subunit 9, isoform 1; mitochondrial ATP synthase, subunit C, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1; ATP5A; ATP5G |
| Gene ID | 516 |
| mRNA Refseq | NM_001002027 |
| Protein Refseq | NP_001002027 |
| MIM | 603192 |
| UniProt ID | P05496 |
| Chromosome Location | 17q21.32 |
| Pathway | Alzheimers disease; Electron Transport Chain; F-type ATPase, eukaryotes |
| Function | hydrogen ion transmembrane transporter activity; lipid binding; transporter activity |
| ◆ Recombinant Proteins | ||
| ATP5G1-12267Z | Recombinant Zebrafish ATP5G1 | +Inquiry |
| RFL21542SF | Recombinant Full Length Pig Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G1) Protein, His-Tagged | +Inquiry |
| ATP5G1-457R | Recombinant Rhesus monkey ATP5G1 Protein, His-tagged | +Inquiry |
| ATP5G1-872R | Recombinant Rat ATP5G1 Protein | +Inquiry |
| RFL19932BF | Recombinant Full Length Bovine Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5G1-8600HCL | Recombinant Human ATP5G1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5G1 Products
Required fields are marked with *
My Review for All ATP5G1 Products
Required fields are marked with *



