Recombinant Human ATP5H protein, GST-tagged
| Cat.No. : | ATP5H-2570H |
| Product Overview : | Recombinant Human ATP5H protein(O75947)(1-161aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-161aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.4 kDa |
| AA Sequence : | AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ] |
| Official Symbol | ATP5H |
| Synonyms | ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; |
| Gene ID | 10476 |
| mRNA Refseq | NM_001003785 |
| Protein Refseq | NP_001003785 |
| UniProt ID | O75947 |
| ◆ Recombinant Proteins | ||
| ATP5H-288R | Recombinant Rhesus Macaque ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5H-3744H | Recombinant Human ATP5H protein, His-tagged | +Inquiry |
| ATP5H-1122HF | Recombinant Full Length Human ATP5H Protein, GST-tagged | +Inquiry |
| ATP5H-15892H | Recombinant Human ATP5H, His-tagged | +Inquiry |
| ATP5H-863M | Recombinant Mouse ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5H Products
Required fields are marked with *
My Review for All ATP5H Products
Required fields are marked with *
