Recombinant Human ATP5H protein, GST-tagged

Cat.No. : ATP5H-2570H
Product Overview : Recombinant Human ATP5H protein(O75947)(1-161aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-161aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 45.4 kDa
AA Sequence : AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ]
Official Symbol ATP5H
Synonyms ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d;
Gene ID 10476
mRNA Refseq NM_001003785
Protein Refseq NP_001003785
UniProt ID O75947

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP5H Products

Required fields are marked with *

My Review for All ATP5H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon