Recombinant Human ATP5SL protein, GST-tagged
| Cat.No. : | ATP5SL-991H |
| Product Overview : | Human ATP5SL full-length ORF ( ADZ15772.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Molecular Mass : | 17.4 kDa |
| AA Sequence : | MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLRTSAGWTSRTSLPCPTLASLRYWWRRCCPIARLWESTGLRA |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DMAC2 distal membrane arm assembly complex 2 [ Homo sapiens (human) ] |
| Official Symbol | DMAC2 |
| Synonyms | DMAC2; distal membrane arm assembly complex 2; ATP5SL; ATP synthase subunit s-like protein; ATP5S like |
| Gene ID | 55101 |
| mRNA Refseq | NM_001167867 |
| Protein Refseq | NP_001161339 |
| MIM | 617262 |
| UniProt ID | Q9NW81 |
| ◆ Recombinant Proteins | ||
| DMAC2-1217HF | Recombinant Full Length Human DMAC2 Protein, GST-tagged | +Inquiry |
| ATP5SL-991H | Recombinant Human ATP5SL protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMAC2 Products
Required fields are marked with *
My Review for All DMAC2 Products
Required fields are marked with *



