Recombinant Human ATP5SL protein, GST-tagged

Cat.No. : ATP5SL-991H
Product Overview : Human ATP5SL full-length ORF ( ADZ15772.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Molecular Mass : 17.4 kDa
AA Sequence : MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLRTSAGWTSRTSLPCPTLASLRYWWRRCCPIARLWESTGLRA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMAC2 distal membrane arm assembly complex 2 [ Homo sapiens (human) ]
Official Symbol DMAC2
Synonyms DMAC2; distal membrane arm assembly complex 2; ATP5SL; ATP synthase subunit s-like protein; ATP5S like
Gene ID 55101
mRNA Refseq NM_001167867
Protein Refseq NP_001161339
MIM 617262
UniProt ID Q9NW81

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMAC2 Products

Required fields are marked with *

My Review for All DMAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon