Recombinant Human ATP6AP1L Protein, GST-tagged
Cat.No. : | ATP6AP1L-4742H |
Product Overview : | Human LOC92270 full-length ORF (1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ATP6AP1L (ATPase H+ Transporting Accessory Protein 1 Like) is a Protein Coding gene. GO annotations related to this gene include proton-transporting ATPase activity, rotational mechanism and proton-transporting ATP synthase activity, rotational mechanism. An important paralog of this gene is ATP6AP1. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MRLWKARVLKLVLKTAKDSRLGLNSKWLSLKLGDAGNPRSLAIRFILTNYNKLSIQSWFSLRRVEIISNNSIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPAFLIGLAMSLILLLVLAYALHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRSQQISKIYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6AP1L ATPase H+ transporting accessory protein 1 like [ Homo sapiens (human) ] |
Official Symbol | ATP6AP1L |
Synonyms | ATP6AP1L; ATPase H+ transporting accessory protein 1 like; V-type proton ATPase subunit S1-like protein; ATPase, H+ transporting, lysosomal accessory protein 1-like; vacuolar proton pump subunit S1-like protein |
Gene ID | 92270 |
mRNA Refseq | NM_001017971 |
Protein Refseq | NP_001017971 |
UniProt ID | Q52LC2 |
◆ Recombinant Proteins | ||
ATP6AP1L-4742H | Recombinant Human ATP6AP1L Protein, GST-tagged | +Inquiry |
ATP6AP1L-5942HF | Recombinant Full Length Human ATP6AP1L Protein, GST-tagged | +Inquiry |
RFL3244HF | Recombinant Full Length Human V-Type Proton Atpase Subunit S1-Like Protein(Atp6Ap1L) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6AP1L Products
Required fields are marked with *
My Review for All ATP6AP1L Products
Required fields are marked with *
0
Inquiry Basket