Recombinant Human ATP6AP1L Protein, GST-tagged

Cat.No. : ATP6AP1L-4742H
Product Overview : Human LOC92270 full-length ORF (1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ATP6AP1L (ATPase H+ Transporting Accessory Protein 1 Like) is a Protein Coding gene. GO annotations related to this gene include proton-transporting ATPase activity, rotational mechanism and proton-transporting ATP synthase activity, rotational mechanism. An important paralog of this gene is ATP6AP1.
Molecular Mass : 51.7 kDa
AA Sequence : MRLWKARVLKLVLKTAKDSRLGLNSKWLSLKLGDAGNPRSLAIRFILTNYNKLSIQSWFSLRRVEIISNNSIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPAFLIGLAMSLILLLVLAYALHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRSQQISKIYV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP6AP1L ATPase H+ transporting accessory protein 1 like [ Homo sapiens (human) ]
Official Symbol ATP6AP1L
Synonyms ATP6AP1L; ATPase H+ transporting accessory protein 1 like; V-type proton ATPase subunit S1-like protein; ATPase, H+ transporting, lysosomal accessory protein 1-like; vacuolar proton pump subunit S1-like protein
Gene ID 92270
mRNA Refseq NM_001017971
Protein Refseq NP_001017971
UniProt ID Q52LC2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6AP1L Products

Required fields are marked with *

My Review for All ATP6AP1L Products

Required fields are marked with *

0
cart-icon