Recombinant Human ATP6AP1L Protein, GST-tagged
| Cat.No. : | ATP6AP1L-4742H |
| Product Overview : | Human LOC92270 full-length ORF (1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ATP6AP1L (ATPase H+ Transporting Accessory Protein 1 Like) is a Protein Coding gene. GO annotations related to this gene include proton-transporting ATPase activity, rotational mechanism and proton-transporting ATP synthase activity, rotational mechanism. An important paralog of this gene is ATP6AP1. |
| Molecular Mass : | 51.7 kDa |
| AA Sequence : | MRLWKARVLKLVLKTAKDSRLGLNSKWLSLKLGDAGNPRSLAIRFILTNYNKLSIQSWFSLRRVEIISNNSIQAVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPAFLIGLAMSLILLLVLAYALHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRSQQISKIYV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP6AP1L ATPase H+ transporting accessory protein 1 like [ Homo sapiens (human) ] |
| Official Symbol | ATP6AP1L |
| Synonyms | ATP6AP1L; ATPase H+ transporting accessory protein 1 like; V-type proton ATPase subunit S1-like protein; ATPase, H+ transporting, lysosomal accessory protein 1-like; vacuolar proton pump subunit S1-like protein |
| Gene ID | 92270 |
| mRNA Refseq | NM_001017971 |
| Protein Refseq | NP_001017971 |
| UniProt ID | Q52LC2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6AP1L Products
Required fields are marked with *
My Review for All ATP6AP1L Products
Required fields are marked with *



