Recombinant Human ATP6V1D protein, GST-tagged
Cat.No. : | ATP6V1D-1005H |
Product Overview : | Human ATP6V1D full-length ORF ( AAH01411, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes the V1 domain D subunit protein. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 52.91 kDa |
AA Sequence : | MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1D ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [ Homo sapiens ] |
Official Symbol | ATP6V1D |
Synonyms | ATP6V1D; ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D; ATP6M, ATPase, H+ transporting, lysosomal (vacuolar proton pump); V-type proton ATPase subunit D; VATD; VMA8; V-ATPase D subunit; V-ATPase subunit D; vacuolar H-ATPase subunit D; vacuolar proton pump D subunit; vacuolar proton pump subunit D; vacuolar ATP synthase subunit D; vacuolar proton-ATPase subunit D; V-ATPase 28 kDa accessory protein; vacuolar proton pump delta polypeptide; ATPase, H+ transporting lysosomal, member M; H(+)-transporting two-sector ATPase, subunit M; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATP6M; |
Gene ID | 51382 |
mRNA Refseq | NM_015994 |
Protein Refseq | NP_057078 |
MIM | 609398 |
UniProt ID | Q9Y5K8 |
◆ Recombinant Proteins | ||
ATP6V1D-468R | Recombinant Rhesus monkey ATP6V1D Protein, His-tagged | +Inquiry |
ATP6V1D-7632Z | Recombinant Zebrafish ATP6V1D | +Inquiry |
ATP6V1D-879M | Recombinant Mouse ATP6V1D Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V1D-2163M | Recombinant Mouse ATP6V1D Protein | +Inquiry |
ATP6V1D-4840C | Recombinant Chicken ATP6V1D | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1D-50HCL | Recombinant Human ATP6V1D lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V1D Products
Required fields are marked with *
My Review for All ATP6V1D Products
Required fields are marked with *
0
Inquiry Basket