Recombinant Human ATP8A2 protein, GST-tagged
Cat.No. : | ATP8A2-6755H |
Product Overview : | Recombinant Human ATP8A2 protein(1085-1188 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1085-1188 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | EDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ATP8A2 ATPase, aminophospholipid transporter, class I, type 8A, member 2 [ Homo sapiens ] |
Official Symbol | ATP8A2 |
Synonyms | ATP8A2; ATPase, aminophospholipid transporter, class I, type 8A, member 2; ATPase, aminophospholipid transporter like, class I, type 8A, member 2 , ATPase, aminophospholipid transporter like, Class I, type 8A, member 2; probable phospholipid-transporting ATPase IB; ATPIB; ML 1; ATPase class I type 8A member 2; ATPase, aminophospholipid transporter-like, class I, type 8A, member 2; IB; ATP; ML-1; DKFZp434B1913; |
mRNA Refseq | NM_016529 |
Protein Refseq | NP_057613 |
MIM | 605870 |
UniProt ID | Q9NTI2 |
Gene ID | 51761 |
◆ Recombinant Proteins | ||
ATP8A2-6755H | Recombinant Human ATP8A2 protein, GST-tagged | +Inquiry |
ATP8A2-886M | Recombinant Mouse ATP8A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp8a2-10054M | Recombinant Mouse Atp8a2, GST-tagged | +Inquiry |
ATP8A2-2174M | Recombinant Mouse ATP8A2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP8A2 Products
Required fields are marked with *
My Review for All ATP8A2 Products
Required fields are marked with *
0
Inquiry Basket