Recombinant Human ATP8A2 protein, GST-tagged

Cat.No. : ATP8A2-6755H
Product Overview : Recombinant Human ATP8A2 protein(1085-1188 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1085-1188 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : EDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name ATP8A2 ATPase, aminophospholipid transporter, class I, type 8A, member 2 [ Homo sapiens ]
Official Symbol ATP8A2
Synonyms ATP8A2; ATPase, aminophospholipid transporter, class I, type 8A, member 2; ATPase, aminophospholipid transporter like, class I, type 8A, member 2 , ATPase, aminophospholipid transporter like, Class I, type 8A, member 2; probable phospholipid-transporting ATPase IB; ATPIB; ML 1; ATPase class I type 8A member 2; ATPase, aminophospholipid transporter-like, class I, type 8A, member 2; IB; ATP; ML-1; DKFZp434B1913;
mRNA Refseq NM_016529
Protein Refseq NP_057613
MIM 605870
UniProt ID Q9NTI2
Gene ID 51761

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP8A2 Products

Required fields are marked with *

My Review for All ATP8A2 Products

Required fields are marked with *

0
cart-icon