Recombinant Human ATPAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATPAF1-3821H |
Product Overview : | ATPAF1 MS Standard C13 and N15-labeled recombinant protein (NP_073582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATPAF1 ATP synthase mitochondrial F1 complex assembly factor 1 [ Homo sapiens (human) ] |
Official Symbol | ATPAF1 |
Synonyms | ATPAF1; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; Atp11p; FLJ22351; homolog of yeast ATP11; ATP11p; FLJ55378; FLJ60653; MGC88060; |
Gene ID | 64756 |
mRNA Refseq | NM_022745 |
Protein Refseq | NP_073582 |
MIM | 608917 |
UniProt ID | Q5TC12 |
◆ Recombinant Proteins | ||
ATPAF1-1020H | Recombinant Human ATPAF1 protein, GST-tagged | +Inquiry |
ATPAF1-3625H | Recombinant Human ATPAF1 protein, His-tagged | +Inquiry |
Atpaf1-1779M | Recombinant Mouse Atpaf1 Protein, Myc/DDK-tagged | +Inquiry |
ATPAF1-3821H | Recombinant Human ATPAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATPAF1-10058H | Recombinant Human ATPAF1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATPAF1 Products
Required fields are marked with *
My Review for All ATPAF1 Products
Required fields are marked with *