Recombinant Human ATPAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ATPAF1-3821H
Product Overview : ATPAF1 MS Standard C13 and N15-labeled recombinant protein (NP_073582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified.
Molecular Mass : 36.4 kDa
AA Sequence : MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADGSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ATPAF1 ATP synthase mitochondrial F1 complex assembly factor 1 [ Homo sapiens (human) ]
Official Symbol ATPAF1
Synonyms ATPAF1; ATP synthase mitochondrial F1 complex assembly factor 1; ATP11; Atp11p; FLJ22351; homolog of yeast ATP11; ATP11p; FLJ55378; FLJ60653; MGC88060;
Gene ID 64756
mRNA Refseq NM_022745
Protein Refseq NP_073582
MIM 608917
UniProt ID Q5TC12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATPAF1 Products

Required fields are marked with *

My Review for All ATPAF1 Products

Required fields are marked with *

0
cart-icon