Recombinant Human ATXN2 protein, GST-tagged
Cat.No. : | ATXN2-1031H |
Product Overview : | Human ATXN2 partial ORF ( NP_002964, 1214 a.a. - 1313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to a group of genes that is associated with microsatellite-expansion diseases, a class of neurological and neuromuscular disorders caused by expansion of short stretches of repetitive DNA. The protein encoded by this gene has two globular domains near the N-terminus, one of which contains a clathrin-mediated trans-Golgi signal and an endoplasmic reticulum exit signal. The encoded cytoplasmic protein localizes to the endoplasmic reticulum and plasma membrane, is involved in endocytosis, and modulates mTOR signals, modifying ribosomal translation and mitochondrial function. The N-terminal region of the protein contains a polyglutamine tract of 14-31 residues that can be expanded in the pathogenic state to 32-200 residues. Intermediate length expansions of this tract increase susceptibility to amyotrophic lateral sclerosis, while long expansions of this tract result in spinocerebellar ataxia-2, an autosomal-dominantly inherited, neurodegenerative disorder. Genome-wide association studies indicate that loss-of-function mutations in this gene may be associated with susceptibility to type I diabetes, obesity and hypertension. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATXN2 ataxin 2 [ Homo sapiens ] |
Official Symbol | ATXN2 |
Synonyms | ATXN2; ataxin 2; SCA2, spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2) , TNRC13; ataxin-2; ATX2; trinucleotide repeat containing 13; spinocerebellar ataxia type 2 protein; trinucleotide repeat-containing gene 13 protein; SCA2; TNRC13; FLJ46772; |
Gene ID | 6311 |
mRNA Refseq | NM_002973 |
Protein Refseq | NP_002964 |
MIM | 601517 |
UniProt ID | Q99700 |
◆ Recombinant Proteins | ||
Atxn2-3688M | Recombinant Mouse Atxn2, His-tagged | +Inquiry |
ATXN2-10069H | Recombinant Human ATXN2 Protein, Non tagged | +Inquiry |
ATXN2-01H | Recombinant Human ATXN2 Protein, His-Tagged | +Inquiry |
ATXN2-156H | Recombinant Human ATXN2 Protein, GST-tagged | +Inquiry |
ATXN2-1031H | Recombinant Human ATXN2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATXN2 Products
Required fields are marked with *
My Review for All ATXN2 Products
Required fields are marked with *
0
Inquiry Basket