Recombinant Human AURKA protein, GST-tagged
| Cat.No. : | AURKA-7843H |
| Product Overview : | Recombinant Human AURKA protein(1-132 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-132 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | AURKA aurora kinase A [ Homo sapiens ] |
| Official Symbol | AURKA |
| Synonyms | AURKA; aurora kinase A; serine/threonine kinase 6 , serine/threonine kinase 15 , STK6, STK15; ARK1; AurA; BTAK; PPP1R47; protein phosphatase 1; regulatory subunit 47; STK7; ARK-1; hARK1; aurora 2; IPL1-related kinase; aurora-related kinase 1; aurora/IPL1-like kinase; serine/threonine kinase 6; aurora/IPL1-related kinase 1; breast tumor-amplified kinase; breast-tumor-amplified kinase; serine/threonine-protein kinase 6; serine/threonine protein kinase 15; serine/threonine-protein kinase 15; serine/threonine-protein kinase aurora-A; protein phosphatase 1, regulatory subunit 47; AIK; AURA; STK6; STK15; AURORA2; MGC34538; |
| Gene ID | 6790 |
| mRNA Refseq | NM_003600 |
| Protein Refseq | NP_003591 |
| MIM | 603072 |
| UniProt ID | O14965 |
| ◆ Recombinant Proteins | ||
| AURKA-655H | Recombinant Human Aurora Kinase A | +Inquiry |
| AURKA-246H | Recombinant Human Aurora Kinase A, GST-tagged, Active | +Inquiry |
| AURKA-11H | Active Recombinant Human AURKA Protein (2-403), N-His tagged | +Inquiry |
| AURKA-0694H | Recombinant Human AURKA Protein (D2-S403), Tag Free | +Inquiry |
| AURKA-34H | Recombinant Human AURKA protein, Flag-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AURKA-8563HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
| AURKA-8562HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
| AURKA-8564HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AURKA Products
Required fields are marked with *
My Review for All AURKA Products
Required fields are marked with *
