Recombinant Human AURKA protein, GST-tagged
Cat.No. : | AURKA-7843H |
Product Overview : | Recombinant Human AURKA protein(1-132 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-132 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | AURKA aurora kinase A [ Homo sapiens ] |
Official Symbol | AURKA |
Synonyms | AURKA; aurora kinase A; serine/threonine kinase 6 , serine/threonine kinase 15 , STK6, STK15; ARK1; AurA; BTAK; PPP1R47; protein phosphatase 1; regulatory subunit 47; STK7; ARK-1; hARK1; aurora 2; IPL1-related kinase; aurora-related kinase 1; aurora/IPL1-like kinase; serine/threonine kinase 6; aurora/IPL1-related kinase 1; breast tumor-amplified kinase; breast-tumor-amplified kinase; serine/threonine-protein kinase 6; serine/threonine protein kinase 15; serine/threonine-protein kinase 15; serine/threonine-protein kinase aurora-A; protein phosphatase 1, regulatory subunit 47; AIK; AURA; STK6; STK15; AURORA2; MGC34538; |
Gene ID | 6790 |
mRNA Refseq | NM_003600 |
Protein Refseq | NP_003591 |
MIM | 603072 |
UniProt ID | O14965 |
◆ Recombinant Proteins | ||
AURKA-47HFL | Recombinant Full Length Human AURKA Protein, C-Flag-tagged | +Inquiry |
AURKA-5222HF | Active Recombinant Full Length Human AURKA Protein, DDK-tagged, Biotinylated | +Inquiry |
AURKA-1059HF | Recombinant Full Length Human AURKA Protein, GST-tagged | +Inquiry |
AURKA-0694H | Recombinant Human AURKA Protein (D2-S403), Tag Free | +Inquiry |
AURKA-7843H | Recombinant Human AURKA protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AURKA-8562HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
AURKA-8564HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
AURKA-8563HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AURKA Products
Required fields are marked with *
My Review for All AURKA Products
Required fields are marked with *