Recombinant Human AURKA protein, His-tagged
| Cat.No. : | AURKA-3176H |
| Product Overview : | Recombinant Human AURKA protein(1-132 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-132 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AURKA aurora kinase A [ Homo sapiens ] |
| Official Symbol | AURKA |
| Synonyms | AURKA; aurora kinase A; serine/threonine kinase 6 , serine/threonine kinase 15 , STK6, STK15; ARK1; AurA; BTAK; PPP1R47; protein phosphatase 1; regulatory subunit 47; STK7; ARK-1; hARK1; aurora 2; IPL1-related kinase; aurora-related kinase 1; aurora/IPL1-like kinase; serine/threonine kinase 6; aurora/IPL1-related kinase 1; breast tumor-amplified kinase; breast-tumor-amplified kinase; serine/threonine-protein kinase 6; serine/threonine protein kinase 15; serine/threonine-protein kinase 15; serine/threonine-protein kinase aurora-A; protein phosphatase 1, regulatory subunit 47; AIK; AURA; STK6; STK15; AURORA2; MGC34538; |
| Gene ID | 6790 |
| mRNA Refseq | NM_003600 |
| Protein Refseq | NP_003591 |
| MIM | 603072 |
| UniProt ID | O14965 |
| ◆ Recombinant Proteins | ||
| Aurka-989M | Recombinant Mouse Aurora Kinase A, GST-tagged | +Inquiry |
| AURKA-2205M | Recombinant Mouse AURKA Protein | +Inquiry |
| AURKA-683H | Recombinant Human Aurora Kinase A, His-tagged | +Inquiry |
| AURKA-47HFL | Recombinant Full Length Human AURKA Protein, C-Flag-tagged | +Inquiry |
| AURKA-549H | Recombinant Human Aurora Kinase A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AURKA-8562HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
| AURKA-8563HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
| AURKA-8564HCL | Recombinant Human AURKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AURKA Products
Required fields are marked with *
My Review for All AURKA Products
Required fields are marked with *
