Recombinant Human AURKA protein, His-tagged

Cat.No. : AURKA-3176H
Product Overview : Recombinant Human AURKA protein(1-132 aa), fused to His tag, was expressed in E. coli.
Availability October 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-132 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALED
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name AURKA aurora kinase A [ Homo sapiens ]
Official Symbol AURKA
Synonyms AURKA; aurora kinase A; serine/threonine kinase 6 , serine/threonine kinase 15 , STK6, STK15; ARK1; AurA; BTAK; PPP1R47; protein phosphatase 1; regulatory subunit 47; STK7; ARK-1; hARK1; aurora 2; IPL1-related kinase; aurora-related kinase 1; aurora/IPL1-like kinase; serine/threonine kinase 6; aurora/IPL1-related kinase 1; breast tumor-amplified kinase; breast-tumor-amplified kinase; serine/threonine-protein kinase 6; serine/threonine protein kinase 15; serine/threonine-protein kinase 15; serine/threonine-protein kinase aurora-A; protein phosphatase 1, regulatory subunit 47; AIK; AURA; STK6; STK15; AURORA2; MGC34538;
Gene ID 6790
mRNA Refseq NM_003600
Protein Refseq NP_003591
MIM 603072
UniProt ID O14965

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AURKA Products

Required fields are marked with *

My Review for All AURKA Products

Required fields are marked with *

0
cart-icon
0
compare icon