Recombinant Human AYP1 protein, GST-tagged
Cat.No. : | AYP1-1051H |
Product Overview : | Human AYP1 full-length ORF ( NP_115569.2, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNASEH2C ribonuclease H2, subunit C [ Homo sapiens ] |
Official Symbol | RNASEH2C |
Synonyms | RNASEH2C; ribonuclease H2, subunit C; ribonuclease H2 subunit C; AGS3; Aicardi Goutieres syndrome 3; AYP1; RNase H2 subunit C; RNase H1 small subunit; ribonuclease HI subunit C; aicardi-Goutieres syndrome 3 protein; FLJ20974; MGC22934; |
Gene ID | 84153 |
mRNA Refseq | NM_032193 |
Protein Refseq | NP_115569 |
MIM | 610330 |
UniProt ID | Q8TDP1 |
◆ Recombinant Proteins | ||
RNASEH2C-7635M | Recombinant Mouse RNASEH2C Protein, His (Fc)-Avi-tagged | +Inquiry |
RNASEH2C-14274M | Recombinant Mouse RNASEH2C Protein | +Inquiry |
RNASEH2C-7491Z | Recombinant Zebrafish RNASEH2C | +Inquiry |
RNASEH2C-3731R | Recombinant Rhesus Macaque RNASEH2C Protein, His (Fc)-Avi-tagged | +Inquiry |
RNASEH2C-1473HF | Recombinant Full Length Human RNASEH2C Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASEH2C Products
Required fields are marked with *
My Review for All RNASEH2C Products
Required fields are marked with *