Recombinant Human AYP1 protein, GST-tagged

Cat.No. : AYP1-1051H
Product Overview : Human AYP1 full-length ORF ( NP_115569.2, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 44.2 kDa
AA Sequence : MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNASEH2C ribonuclease H2, subunit C [ Homo sapiens ]
Official Symbol RNASEH2C
Synonyms RNASEH2C; ribonuclease H2, subunit C; ribonuclease H2 subunit C; AGS3; Aicardi Goutieres syndrome 3; AYP1; RNase H2 subunit C; RNase H1 small subunit; ribonuclease HI subunit C; aicardi-Goutieres syndrome 3 protein; FLJ20974; MGC22934;
Gene ID 84153
mRNA Refseq NM_032193
Protein Refseq NP_115569
MIM 610330
UniProt ID Q8TDP1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RNASEH2C Products

Required fields are marked with *

My Review for All RNASEH2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon